RIC8A Rabbit pAb (APR18018N)

• Background:

  Guanine nucleotide exchange factor (GEF, which can activate some, but not all, G-alpha proteins. Able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G (i-alpha protein, possibly leading to release G (i-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G (i-alpha-GDP complex (By similarity. Also acts as an activator for G (q-alpha (GNAQ protein by enhancing the G (q-coupled receptor-mediated ERK activation.

• Synonyms:

  RIC8A; RIC8

• Gene ID:

  60626

• UniProt:

  Q9NPQ8

• Cellular Locus:

  Cell membrane, Cytoplasm

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 58kDa/59kDa/60kDa Observed MW: 60kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RIC8A Rabbit pAb (APR18018N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=60626

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9NPQ8

• AA Sequence:

  DVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDSDPD