CD1A Rabbit pAb (APR26044N)

CAT: 0882-APR26044N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR26044N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to the plasma membrane and to recycling vesicles of the early endocytic system. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD1A Rabbit pAb (APR26044N) .

Synonyms

CD1A; CD1; FCB6; HTA1; R4; T6

Gene ID

909

UniProt

P06126

Cellular Locus

Cell membrane, Endosome membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=909

Uniprot URL

https://www.uniprot.org/uniprot/P06126

AA Sequence

LKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSD

UniProtKB · P06126

T-cell surface glycoprotein CD1a

CD1A_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P06126
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD1A
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: D3DVD7, Q13962, Q5TDJ8, Q9UMM4, Q9Y5M5

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Biological process

Adaptive immunityImmunity

Cellular component

Cell membraneEndosomeMembrane

PTM

Disulfide bondGlycoprotein

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
APR20044N-01	LHX8 Rabbit pAb (APR20044N)
APR27044N-01	CYTH2 Rabbit pAb (APR27044N)
APR26404N-01	MPP1 Rabbit pAb (APR26404N)
APR26047N-01	CRYAA Rabbit pAb (APR26047N)
APR26042N-01	PDLIM5 Rabbit pAb (APR26042N)
APR26034N-01	GC Rabbit pAb (APR26034N)
APR26944N-01	LGALS3BP Rabbit pAb (APR26944N)
APR26144N-01	PRKCQ Rabbit pAb (APR26144N)
APR26084N-01	KCNJ11 Rabbit pAb (APR26084N)
APR26074N-01	ST6GAL1 Rabbit pAb (APR26074N)

Alternative Products

Catalog	Name
GTR18322395-01	CD1a Rabbit mAb
MBS8545748-01	CD1A Rabbit pAb
MBS8540624-01	CD1A/B Rabbit pAb
A03879-100	CD1a Antibody, mAb, Rabbit
GTR18703034-01	CD1a Rabbit Monoclonal Antibody
E47M60907	CD1A Recombinant Rabbit mAb
YLD1421-01	Rabbit anti-CD1a Antibody
V0018-01	CD1a [ABT-CD1a] Antibody
309722-01	CD1A