[KO Validated] CETN2 Rabbit pAb (APR25796N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] CETN2 Rabbit pAb (APR25796N) - image 1](/gentaur-product-1.webp)
![[KO Validated] CETN2 Rabbit pAb (APR25796N) - image 1](/gentaur-product-1.webp)
[KO Validated] CETN2 Rabbit pAb (APR25796N)
Background:
Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.Synonyms:
CETN2; CALT; CEN2; centrin-2Gene ID:
1069UniProt:
P41208Cellular Locus:
Cytoplasm, Nucleus, centriole, centrosome, cytoskeleton, microtubule organizing centerApplications:
WB (Homo sapiens)Dilution:
WB 1:500 - 1:2000 IF 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 19kDa Observed MW: 20KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CETN2 Rabbit pAb (APR25796N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1069Uniprot URL:
https://www.uniprot.org/uniprot/P41208AA Sequence:
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
