NSMF Rabbit pAb (APR25560N)

• Background:

  The protein encoded by this gene is involved in guidance of olfactory axon projections and migration of luteinizing hormone-releasing hormone neurons. Defects in this gene are a cause of idiopathic hypogonadotropic hypogonadism (IHH) . Several transcript variants encoding different isoforms have been found for this gene.

• Synonyms:

  NSMF; HH9; NELF

• Gene ID:

  26012

• UniProt:

  Q6X4W1

• Cellular Locus:

  Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Nucleus envelope, Nucleus matrix, Nucleus membrane, Peripheral membrane protein, cell cortex, cytoskeleton, dendrite, postsynaptic cell membrane, postsynaptic density, synapse, synaptosome

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 44kDa/56kDa/57kDa/59kDa/60kDa Observed MW: 70kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NSMF Rabbit pAb (APR25560N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26012

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q6X4W1

• AA Sequence:

  FQTATTTMQANFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKGLEAVACDTEGFVPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIERKLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL