CTRL Rabbit pAb (APR25323N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CTRL Rabbit pAb (APR25323N)
Background :
This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme.Synonyms :
CTRL; CTRL1Gene ID :
1506UniProt :
P40313Dilution :
WB 1:500 - 1:2000Form :
LiquidBuffer :
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight :
Calculated MW: 28kDa Observed MW: 28kDaStorage Conditions :
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview :
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CTRL Rabbit pAb (APR25323N) .Gene ID URL :
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1506Uniprot URL :
https://www.uniprot.org/uniprot/P40313AA Sequence :
IVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

