IGF2BP2/IMP2 Rabbit pAb (APR24938N)

CAT:
882-APR24938N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IGF2BP2/IMP2 Rabbit pAb (APR24938N) - image 1

IGF2BP2/IMP2 Rabbit pAb (APR24938N)

  • Background:

    This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four KH domains and two RRM domains. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Alternative promoter usage and alternate splicing result in multiple variants encoding different isoforms.
  • Synonyms:

    IGF2BP2; IMP-2; IMP2; VICKZ2
  • Gene ID:

    10644
  • UniProt:

    Q9Y6M1
  • Cellular Locus:

    Cytoplasm, Nucleus
  • Applications:

    WB (Homo sapiens)
  • Dilution:

    WB 1:200 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 54kDa/58kDa/59kDa/61kDa/66kDa Observed MW: 66kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IGF2BP2/IMP2 Rabbit pAb (APR24938N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10644
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9Y6M1
  • AA Sequence:

    NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK