DNMT3A Rabbit pAb (APR24590N)

• Background:

  CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.

• Synonyms:

  DNMT3A; DNMT3A2; M.HsaIIIA; TBRS; DNMT3A

• Gene ID:

  1788

• UniProt:

  Q9Y6K1

• Cellular Locus:

  Cytoplasm, Nucleus

• Applications:

  WB (Human hepatocellular carcinoma cell line, HCT116, Human cells, BEL-7402, SMMC7721, Homo sapiens, Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:2000 IF 1:20 - 1:100 IP 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 16kDa/81kDa/101kDa Observed MW: 110kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DNMT3A Rabbit pAb (APR24590N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1788

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9Y6K1

• AA Sequence:

  SVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLL