SLAMF7 Rabbit pAb (APR23164N)

CAT: 0882-APR23164N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR23164N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

SLAM family member 7 (SLAMF7), also known as CRACC, CD319, CD2-like receptor-activating cytotoxic cells, and CS1, is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells but not in promyelocytic, B-cell lines, or T-cell lines. In human NK cells, activated SLAMF7 transmits signals following association with the adaptor protein EAT-2 . In the absence of EAT-2, SLAMF7 potently inhibited natural killer cell function. It was also inhibitory in T cells, which are typically devoid of EAT-2. Thus, SLAMF7 can exert activating or inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLAMF7 Rabbit pAb (APR23164N) .

Synonyms

SLAMF7; 19A; CD319; CRACC; CS1

Gene ID

57823

UniProt

Q9NQ25

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/21kDa/22kDa/25kDa/32kDa/37kDa Observed MW: 35-70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57823

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQ25

AA Sequence

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

UniProtKB · Q9NQ25

SLAM family member 7

SLAF7_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: Q9NQ25
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: SLAMF7
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A8K3U1, B4DPU4, B4DPY3, B4DWA3, Q8N6Y8, Q8ND32, Q9NY08, Q9NY23

Protein keywords

Biological process

Adaptive immunityImmunityInnate immunity

Coding sequence diversity

Alternative splicing

Technical term

Direct protein sequencingProteomics identificationReference proteome

PTM

Disulfide bondGlycoprotein

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Cellular component

Membrane

Molecular function

Receptor

Related Products

Catalog	Name
APR29921N-01	SLAMF7 Rabbit pAb (APR29921N)
APR26101N-01	SLAMF7 Rabbit pAb (APR26101N)
APR20164N-01	RPH3A Rabbit pAb (APR20164N)
APR25164N-01	Rad23A Rabbit pAb (APR25164N)
APR23964N-01	KLC2 Rabbit pAb (APR23964N)
APR23166N-01	ELOVL5 Rabbit pAb (APR23166N)
APR23144N-01	HES6 Rabbit pAb (APR23144N)
APR23064N-01	IPO13 Rabbit pAb (APR23064N)
APR29164N	FOXD1 Rabbit pAb (APR29164N)
APR28164N-01	TAMM41 Rabbit pAb (APR28164N)

Alternative Products

Catalog	Name
A16565-01	SLAMF7 Rabbit pAb
GTR17723447-01	SLAMF7 Rabbit Polyclonal Antibody
MBS4764240-01	SLAMF7/CS1 Rabbit mAb
MBS8508127-01	SLAMF7 Antibody (Rabbit Polyclonal)
E43S48210	SLAMF7 Recombinant Rabbit mAb
MBS8535755-01	SLAMF7
APA1426-01	SLAMF7/CS1 Rabbit pAb