COX6C Rabbit pAb (APR22845N)

CAT: 0882-APR22845N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR22845N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COX6C Rabbit pAb (APR22845N) .

Synonyms

COX6C

Gene ID

1345

UniProt

P09669

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1345

Uniprot URL

https://www.uniprot.org/uniprot/P09669

AA Sequence

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK

UniProtKB · P09669

Cytochrome c oxidase subunit 6C

COX6C_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P09669
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: COX6C
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: B2R4D7

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Cellular component

MembraneMitochondrionMitochondrion inner membrane

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
APR28845N-01	SLR1 Rabbit pAb (APR28845N)
APR25845N-01	CDC34 Rabbit pAb (APR25845N)
APR22875N-01	OPN4 Rabbit pAb (APR22875N)
APR22844N-01	RFC1 Rabbit pAb (APR22844N)
APR22745N-01	ZNF587 Rabbit pAb (APR22745N)
APR22545N-01	ACMSD Rabbit pAb (APR22545N)
APR20845N-01	CCDC124 Rabbit pAb (APR20845N)
APR28245N-01	TBXA2R Rabbit pAb (APR28245N)
APR22855N-01	NUR77 Rabbit pAb (APR22855N)
APR22846N-01	OTUB2 Rabbit pAb (APR22846N)

Alternative Products

Catalog	Name
MBS9145299-01	COX6C Rabbit pAb
MBS9465376-01	COX6C Rabbit Polyclonal Antibody
GTR18050314-01	COX6c rabbit pAb Antibody
DL98668A-01	Rabbit anti-COX6C Antibody
MBS8557631-01	COX6C (C-Term) Rabbit pAb
GTR17759545	COX6c Rabbit Polyclonal Antibody (Biotin)
GTR18500869	COX6c Rabbit Polyclonal Antibody (BF350)
GTR18500867	COX6c Rabbit Polyclonal Antibody (BF405)
GTR18500863	COX6c Rabbit Polyclonal Antibody (BF647)
GTR17788156	COX6c Rabbit Polyclonal Antibody (Cy5)