[KO Validated] LDL Receptor (LDLR) Rabbit pAb (APR21548N)

CAT:
882-APR21548N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
[KO Validated] LDL Receptor (LDLR) Rabbit pAb (APR21548N) - image 1

[KO Validated] LDL Receptor (LDLR) Rabbit pAb (APR21548N)

  • Background:

    The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.
  • Synonyms:

    LDLR; FH; FHC; LDLCQ2
  • Gene ID:

    3949
  • UniProt:

    P01130
  • Cellular Locus:

    Cell membrane, Cell surface, Early endosome, Endomembrane system, Golgi apparatus, Late endosome, Lysosome, Membrane, Single-pass type I membrane protein, clathrin-coated pit
  • Applications:

    WB (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 75kDa/76kDa/82kDa/90kDa/95kDa Observed MW: 100-160KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] LDL Receptor (LDLR) Rabbit pAb (APR21548N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3949
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P01130
  • AA Sequence:

    VFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDVA