[KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (APR21093N)
CAT:
882-APR21093N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (APR21093N) - image 1](/gentaur-product-1.webp)
![[KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (APR21093N) - image 1](/gentaur-product-1.webp)
[KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (APR21093N)
Background:
Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.Synonyms:
GSS; GSHS; HEL-S-64p; HEL-S-88nGene ID:
2937UniProt:
P48637Applications:
WB (Rattus norvegicus)Dilution:
WB 1:500 - 1:2000 IF 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 40kDa/52kDa Observed MW: 52KDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (APR21087N5) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2937Uniprot URL:
https://www.uniprot.org/uniprot/P48637AA Sequence:
NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV