NGDN Rabbit pAb (APR21064N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


NGDN Rabbit pAb (APR21064N)
Synonyms:
NGDN; C14orf120; CANu1; LCP5; NGD; lpd-2Gene ID:
25983UniProt:
Q8NEJ9Cellular Locus:
Cell projection, Chromosome, Cytoplasm, Nucleus, axon, centromere, dendrite, filopodium, nucleolusDilution:
WB 1:500 - 1:2000Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 35kDa Observed MW: Refer to FiguresStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NGDN Rabbit pAb (APR21064N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25983Uniprot URL:
https://www.uniprot.org/uniprot/Q8NEJ9AA Sequence:
LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
