JAM2 Rabbit pAb (APR20697N)

CAT: 0882-APR20697N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR20697N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality JAM2 Rabbit pAb (APR20697N) .

Synonyms

JAM2; C21orf43; CD322; JAM-B; JAMB; PRO245; VE-JAM; VEJAM

Gene ID

58494

UniProt

P57087

Cellular Locus

Cell junction, Cell membrane, Single-pass type I membrane protein, tight junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/33kDa/34kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=58494

Uniprot URL

https://www.uniprot.org/uniprot/P57087

AA Sequence

FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS

UniProtKB · P57087

Junctional adhesion molecule B

JAM2_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P57087
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: JAM2
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: JAM-B
EC number: —
Processing: Precursor
Secondary accessions: B2R6T9, B4DGT9, Q6UXG6, Q6YNC1

Protein keywords

Coding sequence diversity

Alternative splicing

Cellular component

Cell junctionCell membraneMembraneTight junction

Technical term

Direct protein sequencingProteomics identificationReference proteome

Disease

Disease variant

PTM

Disulfide bondGlycoprotein

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
APR28817N-01	JAM2 Rabbit pAb (APR28817N)
APR22697N-01	COG4 Rabbit pAb (APR22697N)
APR20997N-01	PPM1M Rabbit pAb (APR20997N)
APR20967N-01	MIIP Rabbit pAb (APR20967N)
APR20698N-01	TP53AIP1 Rabbit pAb (APR20698N)
APR20696N-01	PRDM11 Rabbit pAb (APR20696N)
APR20693N-01	SETD5 Rabbit pAb (APR20693N)
APR20679N-01	RPL26L1 Rabbit pAb (APR20679N)
APR20617N-01	PTPN22 Rabbit pAb (APR20617N)
APR20197N-01	IRF5 Rabbit pAb (APR20197N)

Alternative Products

Catalog	Name
E2509978	JAM2 Rabbit pAb
GTR17706723-01	JAM2 Rabbit Polyclonal Antibody
SL17213R-01	Rabbit Anti-JAM2 antibody
MBS8552244-01	JAM2 (N-Term) Rabbit pAb
GTR17794015	JAM2 Rabbit Polyclonal Antibody (AP)
GTR17758391	JAM2 Rabbit Polyclonal Antibody (Biotin)
GTR18683934-01	CD322/JAM2 Rabbit Polyclonal Antibody
PA7756-01	Rabbit Anti-Human JAM2 pAb
GTR17716857	JAM2 Rabbit Polyclonal Antibody (HRP)
GTR18350635	JAM2 Rabbit Polyclonal Antibody (FITC)