MTTP Rabbit pAb (APR20587N)

• Background:

  MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.

• Synonyms:

  MTTP; ABL; MTP

• Gene ID:

  4547

• UniProt:

  P55157

• Cellular Locus:

  Endoplasmic reticulum

• Dilution:

  WB 1:500 - 1:2000 IHC 1:100 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 16kDa/99kDa Observed MW: 100kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MTTP Rabbit pAb (APR20587N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4547

• Uniprot URL:

  https://www.uniprot.org/uniprot/P55157

• AA Sequence:

  MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHG