Uhrf2 Rabbit pAb (APR20222N)

• Background:

  This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

• Synonyms:

  UHRF2; NIRF; RNF107; TDRD23; URF2; Uhrf2

• Gene ID:

  109113

• UniProt:

  Q7TMI3

• Cellular Locus:

  Nucleus

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 24kDa/57kDa/90kDa Observed MW: 90kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Uhrf2 Rabbit pAb (APR20222N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=109113

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q7TMI3

• AA Sequence:

  DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDPECDLCGGDPDKTCHMCSCHKCGEKRDPNM