COMT Rabbit pAb (APR19556N)
CAT:
882-APR19556N-01
Size:
50 µL
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


COMT Rabbit pAb (APR19556N)
Background:
Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT) . The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters.Synonyms:
COMT; HEL-S-98nGene ID:
1312UniProt:
P21964Cellular Locus:
Cell membrane, Cytoplasm, Extracellular side, Single-pass type II membrane proteinDilution:
WB 1:500 - 1:2000 IP 1:50 - 1:100Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 24kDa/30kDa Observed MW: 25kDa, 30kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COMT Rabbit pAb (APR19556N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1312Uniprot URL:
https://www.uniprot.org/uniprot/P21964AA Sequence:
VGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP