PARD6A Rabbit pAb (APR19374N)

CAT: 0882-APR19374N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR19374N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PARD6A Rabbit pAb (APR19374N) .

Synonyms

PARD6A; PAR-6A; PAR6; PAR6C; PAR6alpha; TAX40; TIP-40

Gene ID

50855

UniProt

Q9NPB6

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, ruffle, tight junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=50855

Uniprot URL

https://www.uniprot.org/uniprot/Q9NPB6

AA Sequence

RGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL

UniProtKB · Q9NPB6

Partitioning defective 6 homolog alpha

PAR6A_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: Q9NPB6
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: PARD6A
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: PAR-6, PAR-6 alpha, PAR-6A
EC number: —
Processing: —
Secondary accessions: O14911, Q9NPJ7

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Biological process

Cell cycleCell division

Cellular component

Cell junctionCell membraneCell projectionCytoplasmCytoskeletonMembraneTight junction

PTM

PhosphoproteinUbl conjugation

Related Products

Catalog	Name
APR25100N-01	PARD6A Rabbit pAb (APR25100N)
APR19674N-01	RRP12 Rabbit pAb (APR19674N)
APR19394N-01	ADIPOR2 Rabbit pAb (APR19394N)
APR19384N-01	NAT2 Rabbit pAb (APR19384N)
APR19377N-01	NRP2 Rabbit pAb (APR19377N)
APR19372N-01	SENP8 Rabbit pAb (APR19372N)
APR19371N-01	RAB14 Rabbit pAb (APR19371N)
APR19324N-01	ACSL5 Rabbit pAb (APR19324N)
APR19304N-01	SLC1A5 Rabbit pAb (APR19304N)
APR19274N-01	S100A2 Rabbit pAb (APR19274N)

Alternative Products

Catalog	Name
A3064-01	PARD6A Rabbit pAb
NBP3-38027-100ul	Rabbit Polyclonal PARD6A Antibody
E10G11083	PARD6A Rabbit Polyclonal Antibody
NBP3-21910-100ul	Rabbit Monoclonal PARD6A Antibody (SR1623)
TA327500	PAR6 (PARD6A) Rabbit Polyclonal Antibody
GTR18379261	Pard6a Rabbit Polyclonal Antibody (Biotin)
526712-01	PARD6A