Smad3 Rabbit pAb (APR18468N)

CAT:
882-APR18468N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Smad3 Rabbit pAb (APR18468N) - image 1

Smad3 Rabbit pAb (APR18468N)

  • Background:

    The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis.
  • Synonyms:

    HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3; SMAD3
  • Gene ID:

    4088
  • UniProt:

    P84022
  • Cellular Locus:

    Cytoplasm, Nucleus
  • Applications:

    WB (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 25kDa/35kDa/43kDa/48kDa Observed MW: 48kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Smad3 Rabbit pAb (APR18467N1) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4088
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P84022
  • AA Sequence:

    FPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA