[KO Validated] NOX4 Rabbit pAb (APR18399N)

CAT:
882-APR18399N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
[KO Validated] NOX4 Rabbit pAb (APR18399N) - image 1

[KO Validated] NOX4 Rabbit pAb (APR18399N)

  • Background:

    This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS) . The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.
  • Synonyms:

    NOX4; KOX; KOX-1; RENOX
  • Gene ID:

    50507
  • UniProt:

    Q9NPH5
  • Cellular Locus:

    Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Nucleus, focal adhesion, nucleolus
  • Applications:

    WB (Homo sapiens, Mus musculus, Rattus norvegicus) IHC (Mus musculus) IF (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 6kDa/25-31kDa/58-66kDa Observed MW: 65KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] NOX4 Rabbit pAb (APR18396N4) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=50507
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9NPH5
  • AA Sequence:

    KENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS