Recombinant Mycobacterium smegmatis Porin MspA (mspA) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1130054-01	Recombinant Mycobacterium smegmatis Enolase (eno)
MBS1130054-02	Recombinant Mycobacterium smegmatis Enolase (eno)
MBS1130054-03	Recombinant Mycobacterium smegmatis Enolase (eno)
MBS1135916-01	Recombinant Mycobacterium smegmatis Ferredoxin (fdxA)
MBS1135916-03	Recombinant Mycobacterium smegmatis Ferredoxin (fdxA)
MBS1249056-01mgYeast	Recombinant Mycobacterium smegmatis Acylphosphatase (acyP)
MBS1111505-02	Recombinant Mycobacterium smegmatis Octanoyltransferase (lipB)
MBS1111505-04	Recombinant Mycobacterium smegmatis Octanoyltransferase (lipB)
MBS1006099-03	Recombinant Mycobacterium smegmatis Thioredoxin (trxA)
MBS1176790-01	Recombinant Mycobacterium smegmatis Aspartokinase (ask)

Recombinant Mycobacterium smegmatis Porin MspA (mspA)

CAT:

399-CSB-YP369785MVX-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Mycobacterium smegmatis Porin MspA (mspA)

Gene Name: mspA
UniProt: A0QR29
Expression Region: 28-211aa
Organism: Mycobacterium smegmatis (strain ATCC 700084 / mc (2)155)
Target Sequence: GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN
Tag: N-terminal 6xHis-tagged
Source: Yeast
Field of Research: Others
Assay Type: Developed Protein
Relevance: The major porin in this organism, forms a water-filled channel which favors the permeation of cations, amino acids, iron Fe3+ and less efficiently phosphate. Does not transport Fe-ExoMS, the predominant siderophore. Plays a role in transport of beta-lactamase and hydrophilic fluoroquinolone antibiotics such as norfloxacin as well as chloramphenicol. There are about 2400 porins in wild-type, 800 in an mspA deletion and 150 in a double mspA-mspC deletion. Different conductance values with maXIma at 2.3 and 4.6 nanosiemens might be caused by a simultaneous reconstitution of MspA channels into the membrane or by the eXIstence of different MspA conformations.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 21.7 kDa
References & Citations: "Ortho-proteogenomics: multiple proteomes investigation through orthology and a new MS-based protocol." Gallien S., Perrodou E., Carapito C., Deshayes C., Reyrat J.-M., Van Dorsselaer A., Poch O., Schaeffer C., Lecompte O. Genome Res. 19:128-135 (2009)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mycobacterium smegmatis Porin MspA (mspA), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-YP369785MVX-03	Recombinant Mycobacterium smegmatis Porin MspA (mspA)
CSB-YP369785MVX-02	Recombinant Mycobacterium smegmatis Porin MspA (mspA)
CSB-EP369785MVX-03	Recombinant Mycobacterium smegmatis Porin MspA (mspA)
CSB-EP369785MVX-02	Recombinant Mycobacterium smegmatis Porin MspA (mspA)
CSB-YP369785MVX-01	Recombinant Mycobacterium smegmatis Porin MspA (mspA)
CSB-EP369785MVX-01	Recombinant Mycobacterium smegmatis Porin MspA (mspA)
CSB-EP368051MVX-03	Recombinant Mycobacterium smegmatis 3-oxosteroid 1-dehydrogenase (ksdD)
CSB-EP368051MVX-01	Recombinant Mycobacterium smegmatis 3-oxosteroid 1-dehydrogenase (ksdD)
CSB-EP314354MVW-03	Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)
CSB-EP314354MVW-01	Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on