CD58 Antibody : Biotin (OAAF08098-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CD58 Antibody : Biotin (OAAF08098-Biotin)
Gene Aliases:
Ag3, LFA3, LFA-3Gene ID:
965Swiss Prot:
P19256Host:
RabbitReactivity:
HumanImmunogen:
The antiserum was produced against synthesized peptide derived from the Internal region of human CD58.Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WB, ELISAPurification:
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.Concentration:
1 mg/mlFormat:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
28 kDaShipping Conditions:
Wet IceSpecificity:
CD58 Antibody detects endogenous levels of CD58 protein.NCBI Gene Symbol:
CD58NCBI GB Accession Number:
CD58Host or Source:
RabbitPeptide Sequence:
QQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNR
