CD58 Antibody

• Gene Name:

  CD58 molecule

• Gene Aliases:

  Ag3; CD58 antigen, (lymphocyte function-associated antigen 3) ; LFA3; LFA-3; lymphocyte function-associated antigen 3; surface glycoprotein LFA-3.

• Gene ID:

  965

• Swiss Prot:

  P19256

• Reactivity:

  Human|Mouse|Rat

• Immunogen:

  The antiserum was produced against synthesized peptide derived from the Internal region of human CD58.

• Target:

  Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  QQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNR

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

• Purification:

  The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1mg/ml

• Reconstitution:

  -20°C

• Molecular Weight:

  28 kDa

• Specificity:

  CD58 Antibody detects endogenous levels of CD58 protein.

• NCBI Gene Symbol:

  CD58

• Host or Source:

  Rabbit

• Protein Name:

  Lymphocyte function-associated antigen 3

• Gene Name URL:

  CD58

• CAS Number:

  9007-83-4