CD58 Antibody

CAT:
247-OAAF08098-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CD58 Antibody - image 1

CD58 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    CD58 molecule
  • Gene Aliases :

    Ag3; CD58 antigen, (lymphocyte function-associated antigen 3) ; LFA3; LFA-3; lymphocyte function-associated antigen 3; surface glycoprotein LFA-3.
  • Gene ID :

    965
  • Swiss Prot :

    P19256
  • Reactivity :

    Human|Mouse|Rat
  • Immunogen :

    The antiserum was produced against synthesized peptide derived from the Internal region of human CD58.
  • Target :

    Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
  • Clonality :

    Polyclonal
  • Type :

    Polyclonal Antibody
  • Sequence :

    QQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNR
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
  • Purification :

    The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    1mg/ml
  • Reconstitution :

    -20°C
  • Molecular Weight :

    28 kDa
  • Specificity :

    CD58 Antibody detects endogenous levels of CD58 protein.
  • NCBI Gene Symbol :

    CD58
  • Host or Source :

    Rabbit
  • Protein Name :

    Lymphocyte function-associated antigen 3
  • Gene Name URL :

    CD58

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide