RGS9 Antibody - N-terminal region : FITC (AVARP09024_T100-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RGS9 Antibody - N-terminal region : FITC (AVARP09024_T100-FITC)
Gene Name:
Regulator of G-protein signaling 9Gene Aliases:
PERRS, RGS9LGene ID:
8787Swiss Prot:
O75916Accession Number:
NP_003826Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Horse, RabbitImmunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human RGS9Target:
RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.Partner Proteins:
ADRB2; Dlg4; UBC; RGS7BP; RGS9BP; GNB5; GNAO1; GNAT1; GUCY2DClonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
IHC, WBConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
49kDaReferences & Citations:
Ajit, S.K., et al., (2004) Biochem. Biophys. Res. Commun. 324 (2),686-691Shipping Conditions:
Wet IceProtein Length:
443NCBI Gene Symbol:
RGS9NCBI GB Accession Number:
RGS9Host or Source:
RabbitProtein Name:
Regulator of G-protein signaling 9Nucleotide Accession Number:
NM_003835Peptide Sequence:
MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ
