Rab11b Antibody - C-terminal : HRP (ARP72410_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Rab11b Antibody - C-terminal : HRP (ARP72410_P050-HRP)
Gene Name:
RAB11B, member RAS oncogene familyGene ID:
79434Swiss Prot:
O35509Accession Number:
NP_116006.1Host:
RabbitReactivity:
RatImmunogen:
The immunogen for Anti-Rab11b antibody is: synthetic peptide directed towards the C-terminal of Rat RB11BTarget:
May be involved in osteoclast motility and membrane turnover [RGD, Feb 2006]Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity purifiedConcentration:
0.5 mg/mlFormat:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
23 kDaShipping Conditions:
Wet IceProtein Length:
218NCBI Gene Symbol:
RAB11BNCBI GB Accession Number:
Rab11bHost or Source:
RabbitPeptide Sequence:
KNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCC
