NMD3 Antibody - C-terminal region : HRP (ARP64485_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


NMD3 Antibody - C-terminal region : HRP (ARP64485_P050-HRP)
Gene Name:
NMD3 homolog (S. cerevisiae)Gene Aliases:
CGI-07Gene ID:
51068Swiss Prot:
Q96D46Accession Number:
NP_057022Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, RabbitTarget:
Ribosomes are composed of 60S and 40S subunits that are assembled in the nucleolus and exported to the cytoplasm through nuclear pore complexes in the nuclear envelope. NMD3 is an adaptor for 60S subunit export via the CRM1 pathway.Partner Proteins:
ZNF622; EIF6; CSNK2A1; VCP; UBA1; STAT1; MRTO4; UBC; OTUD4; XPO1Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 86%; Dog: 86%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 93%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
57kDaShipping Conditions:
Wet IceProtein Length:
503NCBI Gene Symbol:
NMD3NCBI GB Accession Number:
NMD3Host or Source:
RabbitProtein Name:
60S ribosomal export protein NMD3Nucleotide Accession Number:
NM_015938Peptide Sequence:
NKMNSDRVPDVVLIKKSYDRTKRQRRRNWKLKELARERENMDTDDERQYQ
