Dbf4 Antibody - C-terminal region : FITC (ARP52246_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Dbf4 Antibody - C-terminal region : FITC (ARP52246_P050-FITC)
Gene Name:
DBF4 homolog (S. cerevisiae)Gene Aliases:
A, Ask, AA545217Gene ID:
27214Swiss Prot:
Q9QZ41-2Accession Number:
NP_001177646Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, RabbitTarget:
Dbf4 is a regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role DNA in replication and cell proliferation. Required for progression of S phase. The complex CDC7-DBF4A selectively phosphorylates MCM2 subunit at 'Ser-40' and 'Ser-53' and then is involved in regulating the initiation of DNA replication during cell cycle.Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
72kDaShipping Conditions:
Wet IceProtein Length:
662NCBI Gene Symbol:
DBF4NCBI GB Accession Number:
Dbf4Host or Source:
RabbitProtein Name:
Protein DBF4 homolog ANucleotide Accession Number:
NM_001190717Peptide Sequence:
AELDKKRTEYLPAHEDRTCGSPVQSLLDLFQTSEEKSEFLGFTGYTENSG
