Dbf4 Antibody - C-terminal region

• Gene Name:

  DBF4 homolog (S. cerevisiae)

• Gene Aliases:

  A, Ask, AA545217

• Gene ID:

  27214

• Swiss Prot:

  Q9QZ41-2

• Accession Number:

  NP_001177646

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

• Target:

  Dbf4 is a regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role DNA in replication and cell proliferation. Required for progression of S phase. The complex CDC7-DBF4A selectively phosphorylates MCM2 subunit at 'Ser-40' and 'Ser-53' and then is involved in regulating the initiation of DNA replication during cell cycle.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  AELDKKRTEYLPAHEDRTCGSPVQSLLDLFQTSEEKSEFLGFTGYTENSG

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  72kDa

• Protein Length:

  662

• NCBI Gene Symbol:

  DBF4

• Host or Source:

  Rabbit

• Protein Name:

  Protein DBF4 homolog A

• Gene Name URL:

  Dbf4

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_001190717