B4galt6 Antibody - C-terminal region : Biotin (ARP46498_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


B4galt6 Antibody - C-terminal region : Biotin (ARP46498_P050-Biotin)
Gene Name:
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6Gene Aliases:
AA536803, AU022389Gene ID:
56386Swiss Prot:
Q9WVK5Accession Number:
NP_062711Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, ZebrafishImmunogen:
The immunogen is a synthetic peptide corresponding to a region of MouseTarget:
B4galt6 is required for the biosynthesis of glycosphingolipids.Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
45kDaShipping Conditions:
Wet IceProtein Length:
382NCBI Gene Symbol:
B4GALT6NCBI GB Accession Number:
B4galt6Host or Source:
RabbitProtein Name:
Beta-1,4-galactosyltransferase 6Nucleotide Accession Number:
NM_019737Peptide Sequence:
GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
