DHX32 Antibody - N-terminal region : Biotin (ARP36451_P050-Biotin)

• Gene Name:

  DEAH (Asp-Glu-Ala-His) box polypeptide 32

• Gene Aliases:

  DDX32, DHLP1

• Gene ID:

  55760

• Swiss Prot:

  Q7L7V1

• Accession Number:

  NP_060650

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of human DHX32

• Target:

  DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

• Partner Proteins:

  FAM161A; UBC

• Clonality:

  Polyclonal

• Conjugation:

  Biotin

• Type:

  Polyclonal Antibody

• Applications:

  WB

• Purification:

  Affinity Purified

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer.

• Reconstitution:

  All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

• Molecular Weight:

  84kDa

• References & Citations:

  Chen, Y., (2007) Exp. Mol. Pathol. 82 (3), 256-261

• Shipping Conditions:

  Wet Ice

• Protein Length:

  743

• NCBI Gene Symbol:

  DHX32

• NCBI GB Accession Number:

  DHX32

• Host or Source:

  Rabbit

• Protein Name:

  Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32

• Nucleotide Accession Number:

  NM_018180

• Peptide Sequence:

  EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR