DHX32 antibody - N-terminal region (ARP36451_P050)

• Gene Name:

  DEAH (Asp-Glu-Ala-His) box polypeptide 32

• Gene Aliases:

  DDX32, DHLP1

• Gene ID:

  55760

• Swiss Prot:

  Q7L7V1

• Accession Number:

  NP_060650

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of human DHX32

• Target:

  DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

• Partner Proteins:

  FAM161A; UBC

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  84kDa

• Protein Length:

  743

• NCBI Gene Symbol:

  DHX32

• Host or Source:

  Rabbit

• Protein Name:

  Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32

• Gene Name URL:

  DHX32

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_018180