Products for Research Use Only
RegisterLogin

TNF-alpha/TNFSF2, Rabbit

CAT: 0804-HY-P70800-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70800-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Tumour Necrosis Factor alpha (TNF alpha) is a potent pro-inflammatory cytokine[1]. TNF alpha binds to its receptors, mainly TNFR1 and TNFR2, and then transmits molecular signals for biological functions such as inflammation and cell death[2]. TNF alpha stimulates NF-κB pathway via TNFR2 promotes cancer growth, invasion, and metastasis. Anti-TNF-α MAb significantly suppresses the tumor development in colitis-associated cancer (CAC) mouse[3]. TNF alpha as a proneurogenic factor activates the SAPK/JNK Pathway and can facilitate neuronal replacement and brain repair in response to brain injury[4]. TNF-alpha/TNFSF2 protein, Rabbit is a recombinant protein consisting of 158 amino acids (V78-L235) and is produced in E. coli.
Product Name Alternative
TNF-alpha/TNFSF2 protein, Rabbit, Rabbit, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tnf-alpha-protein-rabbit.html
Purity
98.0
Smiles
VTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
Molecular Formula
100009088 (Gene_ID) P04924 (V78-L235) (Accession)
Molecular Weight
Approximately 19.0 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Horiuchi T, et al. Transmembrane TNF-alpha: structure, function and interaction with anti-TNF agents. Rheumatology (Oxford) . 2010 Jul;49 (7) :1215-28.|[2]El-Tahan RR, et al. TNF-α gene polymorphisms and expression. Springerplus. 2016 Sep 7;5 (1) :1508.|[3]Jang DI, et al. The Role of Tumor Necrosis Factor Alpha (TNF-α) in Autoimmune Disease and Current TNF-α Inhibitors in Therapeutics. Int J Mol Sci. 2021 Mar 8;22 (5) :2719.|[4]Berguetti T, et al. TNF-α Modulates P-Glycoprotein Expression and Contributes to Cellular Proliferation via Extracellular Vesicles. Cells. 2019 May 24;8 (5) :500.|[5]Onizawa M, et al. Signaling pathway via TNF-alpha/NF-kappaB in intestinal epithelial cells may be directly involved in colitis-associated carcinogenesis. Am J Physiol Gastrointest Liver Physiol. 2009 Apr;296 (4) :G850-9.|[6]Bernardino L, et al. Tumor necrosis factor-alpha modulates survival, proliferation, and neuronal differentiation in neonatal subventricular zone cell cultures. Stem Cells. 2008 Sep;26 (9) :2361-71.|[7]Matsuno H, et al. The role of TNF-alpha in the pathogenesis of inflammation and joint destruction in rheumatoid arthritis (RA) : a study using a human RA/SCID mouse chimera. Rheumatology (Oxford) . 2002 Mar;41 (3) :329-37.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73443TNF-alpha/TNFSF2, Canine
HY-P70697-01TNF-alpha/TNFSF2, Rat
HY-P73444TNF-alpha/TNFSF2, Cynomolgus
HY-P7058-01TNF-alpha/TNFSF2, Human
HY-P79099-01TNF-alpha/TNFSF2, Equine
HY-P73445-01TNF-alpha/TNFSF2, Ferret
HY-P7302-01TNF-alpha/TNFSF2, Bovine
HY-P700515TNF-alpha/TNFSF2, Sheep (GST)
HY-P70426A-01TNF alpha/TNFSF2, Human (His)
HY-P704246-01TNF-alpha/TNFSF2 , Human (HEK293)

Alternative Products

CatalogName
P518861TNF-alpha; TNFSF2; TNFa Protein (Rabbit)
PKSQ050066-01Recombinant Rabbit TNF-alpha/TNFSF2/TNFa Protein
EK6264Rabbit Tumor necrosis factor (TNF/TNFA/TNFSF2) ELISA Kit
AP26378PU-NTNF alpha (TNF) Rabbit Polyclonal Antibody
KTE90016-01ELISA kit for Rabbit Tumor necrosis factor (TNF/TNFA/TNFSF2)
MBS8548063-01TNF-alpha Rabbit pAb
5670-TG-025Recombinant Rabbit TNF-alpha
MBS9147738-01TNF-alpha Rabbit mAb
C082-01Recombinant Rabbit TNF alpha
GTR18242854-01TNF alpha Rabbit pAb

Popular Products