Products for Research Use Only
RegisterLogin

GDNF, Human (HEK293)

CAT: 0804-HY-P73074-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P73074-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (HEK293) is produced in HEK293 cells, and consists of 103 amino acids (R83-I185) .
Product Name Alternative
GDNF Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdnf-protein-human-hek293.html
Purity
96.00
Smiles
RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Molecular Formula
2668 (Gene_ID) P39905-2 (R83-I185) (Accession)
Molecular Weight
Approximately 13-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P704369-01GDNF , Human (134a.a, HEK293)
HY-P75169-01GDNF, Canine (HEK293, Fc)
HY-P7182-01GDNF, Human
HY-P7182A-01GDNF, Human (His)
HY-P700084AF-01Animal-Free GDNF, Human (His)
HY-P701322-01ITIH5 Protein, Human (HEK293, His-hFc),Human,HEK293
HY-P77050-01LAIR2, Human (HEK293)
HY-P75684-01COL6A3, Human (HEK293)
HY-P7308-01TrkA, Human (HEK293)
HY-P704969Vitronectin, Human (HEK293)

Alternative Products

CatalogName
MBS8113959-01Human GDNF HEK293 Overexpression Lysate
TMPY-02792-01GDNF Protein, Human, Recombinant (HEK293)
MBS8117310-01Canine GDNF HEK293 Overexpression Lysate
MBS8575295-01GDNF, Human
OM297610-01GDNF Human
300-121P-1mgHuman GDNF
PH2044-.1Recombinant Human GDNF
4097-10GDNF, human recombinant
CB-1116001GDNF human rec.
PRP100142-01Human GDNF protein

Popular Products