Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)

• Product Name Alternative:

  Interleukin-1 receptor accessory protein-like 1, EC:3.2.2.6, IL-1-RAPL-1, IL-1RAPL-1, IL1RAPL-1, Oligophrenin-4, Three immunoglobulin domain-containing IL-1 receptor-related 2 (TIGIRR-2), X-linked interleukin-1 receptor accessory protein-like 1, IL1RAPL1, OPHN4

• Gene Name:

  IL1RAPL1

• UniProt:

  Q9NZN1

• Expression Region:

  19-357aa

• Organism:

  Homo sapiens (Human)

• Tag:

  C-terminal hFc1-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Neuroscience

• Endotoxin:

  Less than 1.0 EU/µg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human PTPRD protein (CSB-MP019051HU (A4) ) at 2 μg/mL can bind Human IL1RAPL1 protein. The EC50 is 2.645-3.098 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  66.4 kDa

• References & Citations:

  A truncating mutation in the IL1RAPL1 gene is responsible for X-linked mental retardation in the MRX21 family. Tabolacci E., Pomponi M.G., Pietrobono R., Terracciano A., Chiurazzi P., Neri G. Am. J. Med. Genet. A 140:482-487 (2006)

• Shelf Life:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial

• Target Description:

  LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT