Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)
CAT:
399-CSB-MP011624HU1-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)
Product Name Alternative:
Interleukin-1 receptor accessory protein-like 1, EC:3.2.2.6, IL-1-RAPL-1, IL-1RAPL-1, IL1RAPL-1, Oligophrenin-4, Three immunoglobulin domain-containing IL-1 receptor-related 2Â (TIGIRR-2), X-linked interleukin-1 receptor accessory protein-like 1, IL1RAPL1, OPHN4Gene Name:
IL1RAPL1UniProt:
Q9NZN1Expression Region:
19-357aaOrganism:
Homo sapiens (Human)Tag:
C-terminal hFc1-taggedType:
Active Protein & In Stock ProteinSource:
Mammalian cellField of Research:
NeuroscienceEndotoxin:
Less than 1.0 EU/µg as determined by LAL method.Purity:
Greater than 95% as determined by SDS-PAGE.Bioactivity:
Measured by its binding ability in a functional ELISA. Immobilized Human PTPRD protein (CSB-MP019051HU (A4) ) at 2 μg/mL can bind Human IL1RAPL1 protein. The EC50 is 2.645-3.098 ng/mL.Form:
Lyophilized powderBuffer:
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
66.4 kDaReferences & Citations:
A truncating mutation in the IL1RAPL1 gene is responsible for X-linked mental retardation in the MRX21 family. Tabolacci E., Pomponi M.G., Pietrobono R., Terracciano A., Chiurazzi P., Neri G. Am. J. Med. Genet. A 140:482-487 (2006)Shelf Life:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.Protein Length:
PartialTarget Description:
LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT