Recombinant Human Interferon gamma (IFNG) (Active)

CAT:
399-CSB-MP011050HU1d7-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Interferon gamma (IFNG) (Active) - image 1

Recombinant Human Interferon gamma (IFNG) (Active)

  • Product Name Alternative:

    Interferon gamma, IFN-gamma, Immune interferon, IFNG
  • Gene Name:

    IFNG
  • UniProt:

    P01579
  • Expression Region:

    24-166aa
  • Organism:

    Homo sapiens (Human)
  • Tag:

    C-terminal 10xHis-tagged
  • Type:

    Active Protein & In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Immunology
  • Endotoxin:

    Less than 1.0 EU/µg as determined by LAL method.
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Bioactivity:

    Measured by its binding ability in a functional ELISA.Immobilized Human IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU) .The EC50 is 74.23-96.56 ng/mL.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    18.2 kDa
  • References & Citations:

    Human protein factory for converting the transcriptome into an in vitro- expressed proteome. Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nomura N. Nat. Methods 5:1011-1017 (2008)
  • Shelf Life:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Transmembrane Domains:

    0TM
  • Protein Length:

    Full Length
  • Target Description:

    QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ