Recombinant Human Interferon gamma (IFNG) (Active)

Interferon gamma; IFN-gamma; Immune interferon; IFNG

Recombinant Human IFNG protein (Active)

IFNG

P01579

24-166aa

Homo sapiens (Human)

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

C-terminal 10xHis-tagged

Active Protein & In Stock Protein

Mammalian cell

Immunology

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.

Less than 1.0 EU/μg as determined by LAL method.

Greater than 90% as determined by SDS-PAGE.

Yes

①Measured by its binding ability in a functional ELISA.Immobilized Human IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU) .The EC50 is 74.23-96.56 ng/mL. ②Measured by its ability to inhibit proliferation of HT-29 cells.The ED50 for this effect is 0.2120-0.2940 ng/mL.

Lyophilized powder

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

18.2 kDa

Human protein factory for converting the transcriptome into an in vitro- expressed proteome. Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nomura N. Nat. Methods 5:1011-1017 (2008)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.