Recombinant Human Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9), partial

• Product Name Alternative:

  ADAM 9; ADAM metallopeptidase domain 9; Adam9; ADAM9_HUMAN; Cellular disintegrin-related protein; Cone rod dystrophy 9; CORD9; Disintegrin and metalloproteinase domain-containing protein 9; MCMP; MDC9; Meltrin-gamma; Metalloprotease/disintegrin/cysteine-rich protein 9; Mltng; Myeloma cell metalloproteinase

• Abbreviation:

  Recombinant Human ADAM9 protein, partial

• Gene Name:

  ADAM9

• UniProt:

  Q13443

• Expression Region:

  29-413aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  AARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYS

• Tag:

  C-terminal 10xHis-tagged

• Type:

  Developed Protein

• Source:

  Mammalian cell

• Field of Research:

  Others

• Relevance:

  Metalloprotease that cleaves and releases a number of molecules with important roles in tumorigenesis and angiogenesis, such as TEK, KDR, EPHB4, CD40, VCAM1 and CDH5. May mediate cell-cell, cell-matrix interactions and regulate the motility of cells via interactions with integrins.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  44.8 kDa

• References & Citations:

  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) . The MGC Project Team Genome Res. 14:2121-2127 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial