Recombinant Human Pro-epidermal growth factor (EGF), partial
CAT:
399-CSB-MP007473HUd9-01
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human Pro-epidermal growth factor (EGF), partial
Product Name Alternative:
EGFGene Name:
EGFUniProt:
P01133Expression Region:
971-1023aaOrganism:
Homo sapiens (Human)Tag:
C-terminal hFc1-taggedType:
Developed ProteinSource:
Mammalian cellField of Research:
Signal TransductionEndotoxin:
Not testedPurity:
Greater than 95% as determined by SDS-PAGE.Bioactivity:
Not TestedForm:
Liquid or Lyophilized powderBuffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
35.1 kDaShelf Life:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.Protein Length:
PartialTarget Description:
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR