Recombinant Human Pro-epidermal growth factor (EGF) , partial (Active)

CAT:
399-CSB-AP003711HU-01
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Pro-epidermal growth factor (EGF) , partial (Active) - image 1

Recombinant Human Pro-epidermal growth factor (EGF) , partial (Active)

  • Gene Name:

    EGF
  • UniProt:

    P01133
  • Expression Region:

    971-1023aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
  • Tag:

    Tag-Free
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    Epidermal growth factor (EGF) is a small 53 amino acid residue long protein that contains three disulfide bridges. It is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites.
  • Endotoxin:

    Less than 1.0 EU/µg as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 60-450 pg/ml.
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro
  • Molecular Weight:

    6.2 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3