Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)
CAT:
399-CSB-MP6176MOV-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)
Gene Name:
LTBRUniProt:
A0A2K5VGQ6Expression Region:
28-229aaOrganism:
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)Tag:
C-terminal 10xHis-taggedType:
Active Protein & In Stock ProteinSource:
Mammalian cellField of Research:
Cell BiologyEndotoxin:
Less than 1.0 EU/µg as determined by LAL method.Purity:
Greater than 95% as determined by SDS-PAGE.Bioactivity:
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 11.83-14.23 ng/ml.Form:
Lyophilized powderBuffer:
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
23.6 kDaShelf Life:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.Protein Length:
PartialTarget Description:
SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT