Products for Research Use Only
RegisterLogin

SULT1A2, Human (His)

CAT: 0804-HY-P71001Size: 1 EachDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71001Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Sulfotransferase 1A2 (SULT1A2) is a phenol sulfotransferase with thermostable enzyme activity. SULT1A2 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A2 is also responsible for the sulfonation and activation of minoxidil. SULT1A2 induces the mutagenicity and carcinogenicity of certain substrates by influencing DNA adduct formation. SULT1A2 Protein, Human (His) is the recombinant human-derived SULT1A2 protein, expressed by E. coli , with N-6*His labeled tag.
Product Name Alternative
SULT1A2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sult1a2-protein-human-his.html
Smiles
MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Molecular Formula
6799 (Gene_ID) AAI13728.1 (M1-L295) (Accession)
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS14014SULT1A2 Human Pre-designed siRNA Set A
HY-P70969-01SULT1A1, Human (His)
HY-P71012-01SULT1C2, Human (His)
HY-P71343-01SULT2A1, Human (His)
HY-P70977-01SULT1B1, Human (His)
HY-P71342-01SULT1C4, Human (His)
HY-P71341-01SULT1A3, Human (His, solution)
HY-P71341A-01SULT1A3, Human (N-His)
HY-P76099-01SULT1E1, Human (His, solution)
HY-P76099A-01SULT1E1, Human (N-His)

Alternative Products

CatalogName
TMPJ-00586-01SULT1A2 Protein, Human, Recombinant (His)
P518616SULT1A2 Protein (N-His, Human)
YHE75301Recombinant Human SULT1A2 Protein, N-His
PKSH033085-01Recombinant Human SULT1A2 Protein (His Tag)
E40KMH1764Recombinant Human SULT1A2 Protein, His Tag
AR39075PU-LSuLT1A2 (1-295, His-tag) Human Protein
PV058465SULT1A2 Protein Vector (Human) (pPB-C-His)
PV058468SULT1A2 Protein Vector (Human) (pPM-C-His)
MBS1560946-01Recombinant Human SULT1A2 protein, N-His Tag
PV058466SULT1A2 Protein Vector (Human) (pPB-N-His)

Popular Products