IL-1 beta, Human

CAT:
804-HY-P7028-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-1 beta, Human - image 1

IL-1 beta, Human

  • Description :

    IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli. IL-1 beta Protein, Human consists of 153 amino acids (A117-S269) and is expressed in E. coli.
  • Product Name Alternative :

    IL-1 beta Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/il-1-beta-protein-human.html
  • Purity :

    98.00
  • Smiles :

    APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
  • Molecular Formula :

    3553 (Gene_ID) P01584 (A117-S269) (Accession)
  • Molecular Weight :

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations :

    [1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide