Recombinant Mouse Cytochrome P450 3A11 (Cyp3a11)

Recombinant Mouse Cytochrome P450 3A11 (Cyp3a11)

• Gene Name: Cyp3a11
• UniProt: Q64459
• Expression Region: 1-504aa
• Organism: Mus musculus
• Target Sequence: MDLVSALSLETWVLLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGLWKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDFGPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVLFPFLTPVYEMLNICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHNNSKDKVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPIVLKVVPRDAVITGA
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Source: E.coli
• Field of Research: Others
• Assay Type: Developed Protein
• Relevance: Catalyzes erythromycin N-demethylation, nifedipine oxidation and testosterone 6 beta-hydroxylation.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 65.3 kDa
• References & Citations: "Identification of cytochrome P450 2C2 protein complexes in mouse liver." Li B., Yau P., Kemper B. Proteomics 11:3359-3368 (2011)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.