Recombinant Mouse Cytochrome P450 3A25 (Cyp3a25)

CAT:
399-CSB-EP515508MO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Cytochrome P450 3A25 (Cyp3a25) - image 1

Recombinant Mouse Cytochrome P450 3A25 (Cyp3a25)

  • Product Name Alternative:

    (CYPIIIA25)
  • Abbreviation:

    Recombinant Mouse Cyp3a25 protein
  • Gene Name:

    Cyp3a25
  • UniProt:

    O09158
  • Expression Region:

    1-503aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    MELIPNLSIETWVLLVTSLVLFYIYGTYSHGLFKKLGIPGPKPLPLLGTIFNYYDGMWKFDEDCYKKYGKIWGFYEGPQPILAIMDPEIIKIVLVKECYSVFTNRRFFGPVGFMKKAITISEDEEWKRLRTLLSPTFTSGKLKEMFPIMRQYGDILVRNLRREEEKGEPISMKDIFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFKIFDPFLLSIILFPFLTPIYEMLNFSIFPRDSMNFFKKFVKRMKKERLASNQKNRVDFLQLMMNTQNSKGQESQKALSDLEMAAQAVIFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPNKAPVTYDALMDMEYLDMVVNESLRLYPIAIRLERVSKKDVEINGVFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPERFSKENKGNIDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQIPLKISREPIFQPEKPIILKVVSRDKPRTGS
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Cardiovascular
  • Relevance:

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    65.6 kDa
  • References & Citations:

    "Cloning, sequencing, heterologous expression, and characterization of murine cytochrome P450 3a25* (Cyp3a25), a testosterone 6beta-hydroxylase." Dai D., Bai R., Hodgson E., Rose R.L. J Biochem Mol Toxicol 15:90-99 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length