CD47, Human (HEK293, His)

CAT: 0804-HY-P7336-01Size: 5 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7336-01Size:5 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Name Alternative

CD47 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-his.html

Purity

95.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH

Molecular Formula

961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

Molecular Weight

30-45 kDa

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P72918	CD47, Mouse (HEK293, His)
HY-P78639	CD47, Canine (HEK293, His)
HY-P75401-01	CD47, Rat (HEK293, His)
HY-P72917-01	CD47, Human (HEK293)
HY-P72359-01	CD47, Human (Biotinylated, HEK293, Avi-His)
HY-P78095-01	CD47, Human (Biotinylated, HEK293, His-Avi)
HY-P70820-01	CD47, Mouse (140a.a, HEK293, His)
HY-P704478	CD47 , Human (HEK293, Fc)
HY-P704477	CD47 , Human (HEK293, mFc)
HY-P7335-01	CD47, Human (HEK293, Fc)

Catalog	Name
bs-47066P-01	Recombinant human CD47 Protein, C-His (HEK293)
MBS8114944-01	Human CD47 HEK293 Overexpression Lysate
E24C00048	Human CD47 (Knockout) HEK293 Cell Line
ABC-RC0085	Human CD47 Reporter Cell Line-HEK293
Z04213-500	CD47, His, Human
bs-47067P-01	Recombinant human CD47 Protein, C-hFc (HEK293)
OM300567-01	CD47 Human, IgG-His
32-9878-10	Recombinant Human CD47 (C-His)
UA010014-01	CD47 His Tag Protein, Human
GTR18982496-01	Human CD47 (IgG His) Protein