TLE3, Human (His)

• Description:

  The TLE3 protein is a transcriptional corepressor that inhibits Wnt signaling by binding to transcription factors such as CTNNB1 and TCF family members. It forms homotetramers, hetero-oligomers, and interacts with AES.TLE3 Protein, Human (His) is the recombinant human-derived TLE3 protein, expressed by E. coli , with N-GST labeled tag.

• Product Name Alternative:

  TLE3 Protein, Human (His), Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/tle3-protein-human-gst.html

• Purity:

  98.0

• Smiles:

  SHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY

• Molecular Formula:

  7090 (Gene_ID) Q04726 (S484-Y772) (Accession)

• Molecular Weight:

  Approximately 32 kDa

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins