BeKm-1

CAT:
466-13BEK001-00500
Size:
0.5 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BeKm-1 - image 1

BeKm-1

  • Description:

    BeKm-1 toxin is a peptide toxin that has been isolated from the venom of the Central Asian scorpion Buthus eupeus. BeKm-1 toxin has been reported to be a highly selective inhibitor of the human ether-a-go-go ERG1 channel (hERG1) . BeKm-1 inhibits hERG1 channels expressed in HEK-293 cells with an IC50 of 3.3 nM, but has no effect at 100 nM on human EAG, human SK1, rat SK2, human IK, human BK, KCNQ1/KCNE1, KCNQ2/KCNQ3, and KCNQ4 channels. It has also minimal effects on rat ELK1 channel. BeKm-1 inhibits the human ERG1 + KCNE1 combination transiently expressed in HEK-293 cells with an IC50 value in the range of 10 to 30 nM. BeKm-1 toxin preferentially blocks human ERG channel through the closed (resting) state, although some open channel blockade is also reported to occur.
  • Specifications:

    Selective blocker of ERG1 channel
  • Target:

    K channels
  • Sequence:

    RPTDIKCSESYNCFPVCKSRFGKTNGRCVNGFCDCF
  • Peptide Number:

    13BEK001
  • Disulfide Bonds:

    Cys7-Cys28; Cys13-Cys33; Cys17-Cys35
  • N Terminal Sequence:

    H
  • C Terminal Sequence:

    OH