Products for Research Use Only
RegisterLogin

MIP-2/CXCL2, Mouse

CAT: 0804-HY-P7258-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7258-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. MIP-2/CXCL2 Protein, Mouse is produced in E. coli, and consists of 74 amino acids (A27-N100) .
Product Name Alternative
MIP-2/CXCL2 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mip-2-cxcl2-protein-mouse.html
Purity
98.0
Smiles
GAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Molecular Formula
20310 (Gene_ID) P10889 (G27-N100) (Accession)
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Chaochao Q, et al. Macrophage Inflammatory Protein-2 in High Mobility Group Box 1 Secretion of Macrophage Cells Exposed to Lipopolysaccharide. Cell Physiol Biochem. 2017;42 (3) :913-928.|[2]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[3]Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[4]Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32 (4) :353-68.|[5]Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55 (1) :48-55.|[6]Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558.|[7]Sagar Paudel, et al. CXCL1 regulates neutrophil homeostasis in pneumonia-derived sepsis caused by Streptococcus pneumoniae serotype 3. Blood. 2019 Mar 21;133 (12) :1335-1345.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-168149Mip-IN-2
HY-RS16653Cxcl2 Mouse Pre-designed siRNA Set A
HY-P7263-01MIP-3 alpha/CCL20, Mouse
HY-P7264-01MIP-3 beta/CCL19, Mouse
HY-129615MIP-1072
HY-123733MIP-1095
HY-149861Mip-IN-1
HY-P7191-01GRO-beta/CXCL2, Rat
HY-P7190-01GRO-beta/CXCL2, Human
HY-P7772-01CCL9/10/MIP-1 gamma, Mouse

Alternative Products

CatalogName
Z03326-1MIP-2/CXCL2, Mouse
452-M2-010Recombinant Mouse CXCL2/MIP-2
RC332-13MIP-2, CXCL2, murine (mouse)
MBS9148961-01Recombinant Mouse CXCL2/MIP-2 Protein
MBS8579400-01Mouse MIP-2/CXCL2 ELISA Kit
NR-E10511-01Mouse CXCL2/MIP-2 ELISA Kit
CD00295Recombinant Mouse MIP-2/CXCL2 protein
MBS691971-01Mouse MIP-2 (CXCL2, Gro-beta)
452-M2-010/CFRecombinant Mouse CXCL2/MIP-2 CF
DY452Mouse CXCL2/MIP-2 DuoSet ELISA

Popular Products