IL-37, Human

• Description:

  IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.

• Product Name Alternative:

  IL-37 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/il-37-protein-human.html

• Purity:

  97.04

• Smiles:

  KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

• Molecular Formula:

  27178 (Gene_ID) Q9NZH6-1 (K53-D218) (Accession)

• Molecular Weight:

  Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Lijuan Wang, et al. Interleukin-37: A crucial cytokine with multiple roles in disease and potentially clinical therapy. Oncol Lett. 2018 Apr;15 (4) :4711-4719.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins