Complement C5a, Human

• Description:

  Complement C5/C5a Protein, Human is a recombinant human complement C5a. C5a is a 74-amino acid glycoprotein generated on activation of the C system. Complement C5 is cleaved by proteolysis in the terminal phase of complement activation generating the pro-inflammatory C5a and membrane attack complex nucleator C5b. C5a is an inflammatory mediator generated by complement activation that positively regulates various arms of immune defense, including Toll-like receptor 4 (TLR4) signaling. Complement C5a Protein, Human is a human-derived recombinant protein that expressed by E. coli[1][2].

• Product Name Alternative:

  Complement C5a Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-human.html

• Purity:

  95.20

• Smiles:

  TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

• Molecular Formula:

  727 (Gene_ID) P01031 (T678-R751) (Accession)

• Molecular Weight:

  Approximately 10 kDa

• References & Citations:

  [1]An G, et al. Role of C5a-C5aR axis in the development of atherosclerosis. Sci China Life Sci. 2014;57 (8) :790-794.|[2]Haggadone MD, et al. Bidirectional Crosstalk between C5a Receptors and the NLRP3 Inflammasome in Macrophages and Monocytes. Mediators Inflamm. 2016;2016:1340156.|[3]Li Z, et al., Neutrophil extracellular traps potentiate effector T cells via endothelial senescence in uveitis. JCI Insight. 2025 Jan 23;10 (2) :e180248.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins